Lineage for d4dbvp1 (4dbv P:0-148,P:313-333)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118495Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (12 species)
  7. 118504Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (6 PDB entries)
  8. 118518Domain d4dbvp1: 4dbv P:0-148,P:313-333 [29975]
    Other proteins in same PDB: d4dbvo2, d4dbvp2, d4dbvq2, d4dbvr2

Details for d4dbvp1

PDB Entry: 4dbv (more details), 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+
PDB Compounds: (P:)

SCOP Domain Sequences for d4dbvp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dbvp1 c.2.1.3 (P:0-148,P:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d4dbvp1:

Click to download the PDB-style file with coordinates for d4dbvp1.
(The format of our PDB-style files is described here.)

Timeline for d4dbvp1: