Lineage for d4dbvo1 (4dbv O:0-148,O:313-333)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308576Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)
  7. 308588Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (10 PDB entries)
  8. 308617Domain d4dbvo1: 4dbv O:0-148,O:313-333 [29974]
    Other proteins in same PDB: d4dbvo2, d4dbvp2, d4dbvq2, d4dbvr2

Details for d4dbvo1

PDB Entry: 4dbv (more details), 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

SCOP Domain Sequences for d4dbvo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dbvo1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d4dbvo1:

Click to download the PDB-style file with coordinates for d4dbvo1.
(The format of our PDB-style files is described here.)

Timeline for d4dbvo1: