Lineage for d2dbvr1 (2dbv R:0-148,R:313-333)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828874Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)
  8. 1828910Domain d2dbvr1: 2dbv R:0-148,R:313-333 [29973]
    Other proteins in same PDB: d2dbvo2, d2dbvp2, d2dbvq2, d2dbvr2
    complexed with ndp, so4; mutant

Details for d2dbvr1

PDB Entry: 2dbv (more details), 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+
PDB Compounds: (R:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2dbvr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbvr1 c.2.1.3 (R:0-148,R:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOPe Domain Coordinates for d2dbvr1:

Click to download the PDB-style file with coordinates for d2dbvr1.
(The format of our PDB-style files is described here.)

Timeline for d2dbvr1: