Lineage for d2dbvr1 (2dbv R:0-148,R:313-333)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) 
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins) 
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species) 
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (6 PDB entries) 
Domain d2dbvr1: 2dbv R:0-148,R:313-333 [29973]
Other proteins in same PDB: d2dbvo2, d2dbvp2, d2dbvq2, d2dbvr2
Details for d2dbvr1
PDB Entry: 2dbv (more details), 2.2 Å
PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+
SCOP Domain Sequences for d2dbvr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dbvr1 c.2.1.3 (R:0-148,R:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl
SCOP Domain Coordinates for d2dbvr1:
Click to download the PDB-style file with coordinates for d2dbvr1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2dbvr1:
View in 3D
