Lineage for d2dbvp1 (2dbv P:0-148,P:313-333)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66547Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 66608Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 66612Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (6 PDB entries)
  8. 66622Domain d2dbvp1: 2dbv P:0-148,P:313-333 [29971]
    Other proteins in same PDB: d2dbvo2, d2dbvp2, d2dbvq2, d2dbvr2

Details for d2dbvp1

PDB Entry: 2dbv (more details), 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

SCOP Domain Sequences for d2dbvp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbvp1 c.2.1.3 (P:0-148,P:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d2dbvp1:

Click to download the PDB-style file with coordinates for d2dbvp1.
(The format of our PDB-style files is described here.)

Timeline for d2dbvp1: