SCOP 1.75: Domain d2dbvo1: 2dbv O:0-148,O:313-333

Lineage for d2dbvo1 (2dbv O:0-148,O:313-333)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)

8. Domain d2dbvo1: 2dbv O:0-148,O:313-333 [29970]
   Other proteins in same PDB: d2dbvo2, d2dbvp2, d2dbvq2, d2dbvr2

Details for d2dbvo1

PDB Entry: 2dbv, 2.2 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nadp+

PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d2dbvo1:

Sequence; same for both SEQRES and ATOM records:

>d2dbvo1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

Timeline for d2dbvo1:

• d2dbvo1 first appeared (with stable ids) in SCOP 1.55
  
• d2dbvo1 appears in SCOP 1.73
  
• d2dbvo1 appears in SCOPe 2.01
  
• d2dbvo1 appears in the current release, SCOPe 2.08