SCOPe 2.05: Domain d1dbvq1: 1dbv Q:0-148,Q:313-333

Lineage for d1dbvq1 (1dbv Q:0-148,Q:313-333)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)

8. Domain d1dbvq1: 1dbv Q:0-148,Q:313-333 [29968]
   Other proteins in same PDB: d1dbvo2, d1dbvp2, d1dbvq2, d1dbvr2
   complexed with nad, so4; mutant

Details for d1dbvq1

PDB Entry: 1dbv, 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+

PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1dbvq1:

Sequence; same for both SEQRES and ATOM records:

>d1dbvq1 c.2.1.3 (Q:0-148,Q:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

Timeline for d1dbvq1:

• d1dbvq1 first appeared (with stable ids) in SCOP 1.55
  
• d1dbvq1 appears in SCOPe 2.04
  
• d1dbvq1 appears in SCOPe 2.06
  
• d1dbvq1 appears in the current release, SCOPe 2.08