SCOP 1.55: Domain d1dbvo1: 1dbv O:0-148,O:313-333

Lineage for d1dbvo1 (1dbv O:0-148,O:313-333)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)

7. Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (6 PDB entries)

8. Domain d1dbvo1: 1dbv O:0-148,O:313-333 [29966]
   Other proteins in same PDB: d1dbvo2, d1dbvp2, d1dbvq2, d1dbvr2

Details for d1dbvo1

PDB Entry: 1dbv, 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+

SCOP Domain Sequences for d1dbvo1:

Sequence; same for both SEQRES and ATOM records:

>d1dbvo1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

Timeline for d1dbvo1:

• d1dbvo1 appears in SCOP 1.57
  
• d1dbvo1 appears in the current release, SCOPe 2.08