![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
![]() | Species Escherichia coli [TaxId:562] [51802] (9 PDB entries) Uniprot P06977 |
![]() | Domain d1dc4b1: 1dc4 B:0-148,B:313-330 [29961] Other proteins in same PDB: d1dc4a2, d1dc4b2 complexed with g3p |
PDB Entry: 1dc4 (more details), 2.5 Å
SCOPe Domain Sequences for d1dc4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dc4b1 c.2.1.3 (B:0-148,B:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk
Timeline for d1dc4b1: