Lineage for d1dc3b1 (1dc3 B:0-148,B:313-330)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387801Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 387918Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)
  7. 387971Species Escherichia coli [TaxId:562] [51802] (6 PDB entries)
  8. 387977Domain d1dc3b1: 1dc3 B:0-148,B:313-330 [29959]
    Other proteins in same PDB: d1dc3a2, d1dc3b2

Details for d1dc3b1

PDB Entry: 1dc3 (more details), 2.5 Å

PDB Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes

SCOP Domain Sequences for d1dc3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc3b1 c.2.1.3 (B:0-148,B:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

SCOP Domain Coordinates for d1dc3b1:

Click to download the PDB-style file with coordinates for d1dc3b1.
(The format of our PDB-style files is described here.)

Timeline for d1dc3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dc3b2