| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
| Protein automated matches [310868] (5 species) not a true protein |
| Species SARS coronavirus [TaxId:227859] [311282] (4 PDB entries) |
| Domain d4mm3b2: 4mm3 B:63-316 [299532] Other proteins in same PDB: d4mm3a_, d4mm3b1 automated match to d2fe8a2 complexed with zn |
PDB Entry: 4mm3 (more details), 2.75 Å
SCOPe Domain Sequences for d4mm3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mm3b2 d.3.1.23 (B:63-316) automated matches {SARS coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsytttik
Timeline for d4mm3b2: