Lineage for d4mm3b2 (4mm3 B:63-316)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498013Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 protein domains)
    C-terminal part of Pfam PF08715
  6. 2498033Protein automated matches [310868] (5 species)
    not a true protein
  7. 2498042Species SARS coronavirus [TaxId:227859] [311282] (4 PDB entries)
  8. 2498047Domain d4mm3b2: 4mm3 B:63-316 [299532]
    Other proteins in same PDB: d4mm3a_, d4mm3b1, d4mm3b3
    automated match to d2fe8a2
    complexed with zn

Details for d4mm3b2

PDB Entry: 4mm3 (more details), 2.75 Å

PDB Description: crystal structure of sars-cov papain-like protease plpro in complex with ubiquitin aldehyde
PDB Compounds: (B:) papain-like proteinase

SCOPe Domain Sequences for d4mm3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mm3b2 d.3.1.23 (B:63-316) automated matches {SARS coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsytttik

SCOPe Domain Coordinates for d4mm3b2:

Click to download the PDB-style file with coordinates for d4mm3b2.
(The format of our PDB-style files is described here.)

Timeline for d4mm3b2:

View in 3D
Domains from other chains:
(mouse over for more information)
d4mm3a_