Lineage for d4mm3b1 (4mm3 B:2-62)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (24 species)
    not a true protein
  7. 2502881Species SARS coronavirus [TaxId:227859] [311281] (4 PDB entries)
  8. 2502886Domain d4mm3b1: 4mm3 B:2-62 [299531]
    Other proteins in same PDB: d4mm3a_, d4mm3b2, d4mm3b3
    automated match to d2fe8a1
    complexed with zn

Details for d4mm3b1

PDB Entry: 4mm3 (more details), 2.75 Å

PDB Description: crystal structure of sars-cov papain-like protease plpro in complex with ubiquitin aldehyde
PDB Compounds: (B:) papain-like proteinase

SCOPe Domain Sequences for d4mm3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mm3b1 d.15.1.0 (B:2-62) automated matches {SARS coronavirus [TaxId: 227859]}
evktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlps
d

SCOPe Domain Coordinates for d4mm3b1:

Click to download the PDB-style file with coordinates for d4mm3b1.
(The format of our PDB-style files is described here.)

Timeline for d4mm3b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4mm3a_