Lineage for d1dc5b1 (1dc5 B:0-148,B:313-330)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20369Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 20395Species Escherichia coli [TaxId:562] [51802] (6 PDB entries)
  8. 20399Domain d1dc5b1: 1dc5 B:0-148,B:313-330 [29953]
    Other proteins in same PDB: d1dc5a2, d1dc5b2

Details for d1dc5b1

PDB Entry: 1dc5 (more details), 2 Å

PDB Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes

SCOP Domain Sequences for d1dc5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc5b1 c.2.1.3 (B:0-148,B:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

SCOP Domain Coordinates for d1dc5b1:

Click to download the PDB-style file with coordinates for d1dc5b1.
(The format of our PDB-style files is described here.)

Timeline for d1dc5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dc5b2