Lineage for d1gadp1 (1gad P:0-148,P:313-330)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1152379Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1152583Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1152639Species Escherichia coli [TaxId:562] [51802] (9 PDB entries)
    Uniprot P06977
  8. 1152641Domain d1gadp1: 1gad P:0-148,P:313-330 [29951]
    Other proteins in same PDB: d1gado2, d1gadp2
    complexed with nad; mutant

Details for d1gadp1

PDB Entry: 1gad (more details), 1.8 Å

PDB Description: comparison of the structures of wild type and a n313t mutant of escherichia coli glyceraldehyde 3-phosphate dehydrogenases: implication for nad binding and cooperativity
PDB Compounds: (P:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gadp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gadp1 c.2.1.3 (P:0-148,P:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

SCOPe Domain Coordinates for d1gadp1:

Click to download the PDB-style file with coordinates for d1gadp1.
(The format of our PDB-style files is described here.)

Timeline for d1gadp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gadp2