Lineage for d1gadp1 (1gad P:0-148,P:313-330)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20369Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 20395Species Escherichia coli [TaxId:562] [51802] (6 PDB entries)
  8. 20397Domain d1gadp1: 1gad P:0-148,P:313-330 [29951]
    Other proteins in same PDB: d1gado2, d1gadp2

Details for d1gadp1

PDB Entry: 1gad (more details), 1.8 Å

PDB Description: comparison of the structures of wild type and a n313t mutant of escherichia coli glyceraldehyde 3-phosphate dehydrogenases: implication for nad binding and cooperativity

SCOP Domain Sequences for d1gadp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gadp1 c.2.1.3 (P:0-148,P:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

SCOP Domain Coordinates for d1gadp1:

Click to download the PDB-style file with coordinates for d1gadp1.
(The format of our PDB-style files is described here.)

Timeline for d1gadp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gadp2