Lineage for d4mh1a1 (4mh1 A:0-555)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066579Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2066580Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2066633Family b.70.1.0: automated matches [227985] (1 protein)
    not a true family
  6. 2066634Protein automated matches [227986] (3 species)
    not a true protein
  7. 2066635Species Ketogulonicigenium vulgare [TaxId:880591] [267967] (1 PDB entry)
  8. 2066636Domain d4mh1a1: 4mh1 A:0-555 [299474]
    Other proteins in same PDB: d4mh1a2, d4mh1b2
    automated match to d4cvba_
    complexed with ca, pqq

Details for d4mh1a1

PDB Entry: 4mh1 (more details), 2.7 Å

PDB Description: Crystal structure and functional studies of quinoprotein L-sorbose dehydrogenase from Ketogulonicigenium vulgare Y25
PDB Compounds: (A:) Sorbose dehydrogenase

SCOPe Domain Sequences for d4mh1a1:

Sequence, based on SEQRES records: (download)

>d4mh1a1 b.70.1.0 (A:0-555) automated matches {Ketogulonicigenium vulgare [TaxId: 880591]}
aqtaitdemlanppagewisygqnqenyrhspltqittenvgqlqlvwargmqpgkvqvt
plihdgvmylanpgdviqaidaktgdliwehrrqlpniatlnsfgeptrgmalygtnvyf
vswdnhlvaldmgtgqvvfdvdrgqgdervsnssgpivangtivagstcqyspfgcfvsg
hdsatgeelwrnyfiprageegdetwgndyesrwmtgawgqitydpvtnlvhygstavgp
asetqrgtpggtlygtntrfavrpdtgeivwrhqtlprdnwdqectfemmvtnvdvqpst
emeglqsinpnaatgerrvltgvpcktgtmwqfdaetgeflwardtnyqnmiesidengi
vtvnedailkeldveydvcptflggrdwpsaalnpdsgiyfiplnnvcydmmavdqefts
mdvyntsnvtklppgkdmigridaidistgrtlwsveraaanyspvlstgggvlfnggtd
ryfralsqetgetlwqtrlatvasgqaisyevdgmqyvaiagggvsygsglnsalagerv
dstaignavyvfalpq

Sequence, based on observed residues (ATOM records): (download)

>d4mh1a1 b.70.1.0 (A:0-555) automated matches {Ketogulonicigenium vulgare [TaxId: 880591]}
aqtaitdemlanppagewisygqnqenyrhspltqittenvgqlqlvwargmqpgkvqvt
plihdgvmylanpgdviqaidaktgdliwehrrqlpniatlsfgeptrgmalygtnvyfv
swdnhlvaldmgtgqvvfdvdrgqgdervsnssgpivangtivagstgcfvsghdsatge
elwrnyfiprarwmtgawgqitydpvtnlvhygstavgtlygtntrfavrpdtgeivwrh
qtlprdnwdqectfemmvtnvdvqpstemeglqsinpnaatgerrvltgvpcktgtmwqf
daetgeflwardtnyqnmiesidengivtvnedaieydvcptflggrdwpsaalnpdsgi
yfiplnnvcydmmntsnvtklppgkdmigridaidistgrtlwsveraaanyspvlstgg
gvlfnggtdryfralsqetgetlwqtrlatvasgqaisyevdgmqyvaiagggvsygsgl
nsalagervdstaignavyvfalpq

SCOPe Domain Coordinates for d4mh1a1:

Click to download the PDB-style file with coordinates for d4mh1a1.
(The format of our PDB-style files is described here.)

Timeline for d4mh1a1:

  • d4mh1a1 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4mh1a2