Lineage for d2ae2a_ (2ae2 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820658Protein Tropinone reductase [51795] (3 species)
  7. 820662Species Jimsonweed (Datura stramonium), II [TaxId:4076] [51797] (4 PDB entries)
  8. 820663Domain d2ae2a_: 2ae2 A: [29945]

Details for d2ae2a_

PDB Entry: 2ae2 (more details), 1.9 Å

PDB Description: tropinone reductase-ii complexed with nadp+ and pseudotropine
PDB Compounds: (A:) protein (tropinone reductase-II)

SCOP Domain Sequences for d2ae2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]}
agrwnlegctalvtggsrgigygiveelaslgasvytcsrnqkelndcltqwrskgfkve
asvcdlssrserqelmntvanhfhgklnilvnnagiviykeakdytvedyslimsinfea
ayhlsvlahpflkasergnvvfissvsgalavpyeavygatkgamdqltrclafewakdn
irvngvgpgviatslvemtiqdpeqkenlnklidrcalrrmgepkelaamvaflcfpaas
yvtgqiiyvdgglmancgf

SCOP Domain Coordinates for d2ae2a_:

Click to download the PDB-style file with coordinates for d2ae2a_.
(The format of our PDB-style files is described here.)

Timeline for d2ae2a_: