| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.301: Sus1-like [310571] (1 superfamily) 5 helices; articulated hairpin fold |
Superfamily a.301.1: Sus1-like [310603] (1 family) ![]() Pfam PF10163 interactions with Sac3, Cdc31 described in PubMed 19328066 |
| Family a.301.1.1: Sus1-like [310653] (3 proteins) |
| Protein Sus1 [310814] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (14 PDB entries) |
| Domain d4mbec_: 4mbe C: [299429] Other proteins in same PDB: d4mbea_, d4mbed_ automated match to d3fwbc_ protein/RNA complex; complexed with ca |
PDB Entry: 4mbe (more details), 2.61 Å
SCOPe Domain Sequences for d4mbec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mbec_ a.301.1.1 (C:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tmdtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqi
lstvepkalemvsdstretvlkqirefleeivdt
Timeline for d4mbec_: