Lineage for d1qsgg1 (1qsg G:3-260)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842037Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2842067Species Escherichia coli [TaxId:562] [51794] (13 PDB entries)
  8. 2842074Domain d1qsgg1: 1qsg G:3-260 [29941]
    Other proteins in same PDB: d1qsga2, d1qsgb2, d1qsgc2, d1qsgd2, d1qsge2, d1qsgf2, d1qsgg2, d1qsgh2
    complexed with glc, nad, tcl

Details for d1qsgg1

PDB Entry: 1qsg (more details), 1.75 Å

PDB Description: crystal structure of enoyl reductase inhibition by triclosan
PDB Compounds: (G:) Enoyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d1qsgg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsgg1 c.2.1.2 (G:3-260) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}
flsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivlq
cdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdissy
sfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpegv
rvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagisg
evvhvdggfsiaamnele

SCOPe Domain Coordinates for d1qsgg1:

Click to download the PDB-style file with coordinates for d1qsgg1.
(The format of our PDB-style files is described here.)

Timeline for d1qsgg1: