Lineage for d1qsgd_ (1qsg D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20186Protein Enoyl-ACP reductase [51791] (3 species)
  7. 20187Species Escherichia coli [TaxId:562] [51794] (7 PDB entries)
  8. Domain d1qsgd_: 1qsg D: [29938]

Details for d1qsgd_

PDB Entry: 1qsg (more details)

PDB Description: crystal structure of enoyl reductase inhibition by triclosan

SCOP Domain Sequences for d1qsgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsgd_ c.2.1.2 (D:) Enoyl-ACP reductase {Escherichia coli}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamnel

SCOP Domain Coordinates for d1qsgd_ are not available.

Timeline for d1qsgd_:

Domains from other chains:
(mouse over for more information)
d1qsga_, d1qsgb_, d1qsgc_, d1qsge_, d1qsgf_, d1qsgg_, d1qsgh_