Lineage for d1qsgc_ (1qsg C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66266Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)
  6. 66395Protein Enoyl-ACP reductase [51791] (3 species)
  7. 66396Species Escherichia coli [TaxId:562] [51794] (7 PDB entries)
  8. 66415Domain d1qsgc_: 1qsg C: [29937]

Details for d1qsgc_

PDB Entry: 1qsg (more details)

PDB Description: crystal structure of enoyl reductase inhibition by triclosan

SCOP Domain Sequences for d1qsgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsgc_ c.2.1.2 (C:) Enoyl-ACP reductase {Escherichia coli}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamnel

SCOP Domain Coordinates for d1qsgc_:

Click to download the PDB-style file with coordinates for d1qsgc_.
(The format of our PDB-style files is described here.)

Timeline for d1qsgc_: