![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Enoyl-ACP reductase [51791] (11 species) |
![]() | Species Escherichia coli [TaxId:562] [51794] (13 PDB entries) |
![]() | Domain d1qsgc1: 1qsg C:3-259 [29937] Other proteins in same PDB: d1qsga2, d1qsgb2, d1qsgc2, d1qsgd2, d1qsge2, d1qsgf2, d1qsgg2, d1qsgh2 complexed with glc, nad, tcl |
PDB Entry: 1qsg (more details), 1.75 Å
SCOPe Domain Sequences for d1qsgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsgc1 c.2.1.2 (C:3-259) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} flsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivlq cdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdissy sfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpegv rvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagisg evvhvdggfsiaamnel
Timeline for d1qsgc1: