Lineage for d4lwzd1 (4lwz D:1456-1848)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008071Protein automated matches [310888] (2 species)
    not a true protein
  7. 2008074Species Human (Homo sapiens) [TaxId:9606] [311399] (4 PDB entries)
  8. 2008078Domain d4lwzd1: 4lwz D:1456-1848 [299360]
    Other proteins in same PDB: d4lwza_, d4lwzc_, d4lwzd2
    automated match to d4j5ma_
    complexed with gdp, mg

Details for d4lwzd1

PDB Entry: 4lwz (more details), 2.55 Å

PDB Description: Crystal structure of Myo5b globular tail domain in complex with inactive Rab11a
PDB Compounds: (D:) Unconventional myosin-Vb

SCOPe Domain Sequences for d4lwzd1:

Sequence, based on SEQRES records: (download)

>d4lwzd1 a.118.27.1 (D:1456-1848) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvtvqrkekdfqgmleyhkedeallirnlvtdlkpqmlsgtvpclpayilymcirhadyt
nddlkvhslltstingikkvlkkhnddfemtsfwlsntcrllhclkqysgdegfmtqnta
kqnehclknfdlteyrqvlsdlsiqiyqqlikiaegvlqpmivsamlenesiqglsgvkp
tgyrkrsssmadgdnsycleaiirqmnafhtvmcdqgldpeiilqvfkqlfyminavtln
nlllrkdvcswstgmqlrynisqleewlrgrnlhqsgavqtmepliqaaqllqlkkktqe
daeaicslctslstqqivkilnlytplnefeervtvafirtiqaqlqerndpqqllldak
hmfpvlfpfnpssltmdsihipaclnleflnev

Sequence, based on observed residues (ATOM records): (download)

>d4lwzd1 a.118.27.1 (D:1456-1848) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvtvqrkekdfqgmleyhkedeallirnlvtdlkpqmlsgtvpclpayilymcirhadyt
nddlkvhslltstingikkvlkkhnddfemtsfwlsntcrllhclkqysgdegfmtqnta
kqnehclknfdlteyrqvlsdlsiqiyqqlikiaegvlqpvsamlenesycleaiirqmn
afhtvmcdqgldpeiilqvfkqlfyminavtlnndvcswstgmqlrynisqleewlrgrn
lhqsgavqtmepliqaaqllqlktqedaeaicslctstqqivkilnlytpeervtvafir
tiqaqlqedakhmfpvlfpfnpssltmdsihipaclnleflnev

SCOPe Domain Coordinates for d4lwzd1:

Click to download the PDB-style file with coordinates for d4lwzd1.
(The format of our PDB-style files is described here.)

Timeline for d4lwzd1:

  • d4lwzd1 is new in SCOPe 2.06-stable