Lineage for d1d8ab_ (1d8a B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1827463Protein Enoyl-ACP reductase [51791] (11 species)
  7. 1827480Species Escherichia coli [TaxId:562] [51794] (13 PDB entries)
  8. 1827514Domain d1d8ab_: 1d8a B: [29932]
    complexed with nad, tcl

Details for d1d8ab_

PDB Entry: 1d8a (more details), 2.2 Å

PDB Description: e. coli enoyl reductase/nad+/triclosan complex
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d1d8ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ab_ c.2.1.2 (B:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamne

SCOPe Domain Coordinates for d1d8ab_:

Click to download the PDB-style file with coordinates for d1d8ab_.
(The format of our PDB-style files is described here.)

Timeline for d1d8ab_: