Lineage for d1d8ab_ (1d8a B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20186Protein Enoyl-ACP reductase [51791] (3 species)
  7. 20187Species Escherichia coli [TaxId:562] [51794] (7 PDB entries)
  8. 20201Domain d1d8ab_: 1d8a B: [29932]

Details for d1d8ab_

PDB Entry: 1d8a (more details), 2.2 Å

PDB Description: e. coli enoyl reductase/nad+/triclosan complex

SCOP Domain Sequences for d1d8ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ab_ c.2.1.2 (B:) Enoyl-ACP reductase {Escherichia coli}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamne

SCOP Domain Coordinates for d1d8ab_:

Click to download the PDB-style file with coordinates for d1d8ab_.
(The format of our PDB-style files is described here.)

Timeline for d1d8ab_: