SCOPe 2.06: Domain d1dfic_: 1dfi C:

Lineage for d1dfic_ (1dfi C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Escherichia coli [TaxId:562] [51794] (13 PDB entries)

8. Domain d1dfic_: 1dfi C: [29925]
   complexed with nad

Details for d1dfic_

PDB Entry: 1dfi, 2.09 Å

PDB Description: x-ray structure of escherichia coli enoyl reductase with bound nad

PDB Compounds: (C:) enoyl acyl carrier protein reductase

SCOPe Domain Sequences for d1dfic_:

Sequence, based on SEQRES records:

>d1dfic_ c.2.1.2 (C:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamne

Sequence, based on observed residues (ATOM records):

>d1dfic_ c.2.1.2 (C:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlmlahceavtpirrtvtiedvgnsaaflcsdlsagisgevvhvdggf
siaamne

Timeline for d1dfic_:

• d1dfic_ first appeared (with stable ids) in SCOP 1.55
  
• d1dfic_ appears in SCOPe 2.05
  
• d1dfic_ appears in SCOPe 2.07
  
• d1dfic_ appears in the current release, SCOPe 2.08