Lineage for d1qg6d_ (1qg6 D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20186Protein Enoyl-ACP reductase [51791] (3 species)
  7. 20187Species Escherichia coli [TaxId:562] [51794] (7 PDB entries)
  8. 20191Domain d1qg6d_: 1qg6 D: [29922]

Details for d1qg6d_

PDB Entry: 1qg6 (more details), 1.9 Å

PDB Description: crystal structure of e. coli enoyl acyl carrier protein reductase in complex with nad and triclosan

SCOP Domain Sequences for d1qg6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg6d_ c.2.1.2 (D:) Enoyl-ACP reductase {Escherichia coli}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamne

SCOP Domain Coordinates for d1qg6d_:

Click to download the PDB-style file with coordinates for d1qg6d_.
(The format of our PDB-style files is described here.)

Timeline for d1qg6d_: