Lineage for d1qg6a_ (1qg6 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1827463Protein Enoyl-ACP reductase [51791] (11 species)
  7. 1827480Species Escherichia coli [TaxId:562] [51794] (13 PDB entries)
  8. 1827489Domain d1qg6a_: 1qg6 A: [29919]
    complexed with nad, tcl

Details for d1qg6a_

PDB Entry: 1qg6 (more details), 1.9 Å

PDB Description: crystal structure of e. coli enoyl acyl carrier protein reductase in complex with nad and triclosan
PDB Compounds: (A:) protein (enoyl-[acyl-carrier protein] reductase)

SCOPe Domain Sequences for d1qg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg6a_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}
gflsgkrilvtgvasklsiaygiaqamhregaelaftyqndklkgrveefaaqlgsdivl
qcdvaedasidtmfaelgkvwpkfdgfvhsigfapgdqldgdyvnavtregfkiahdiss
ysfvamakacrsmlnpgsalltlsylgaeraipnynvmglakasleanvrymanamgpeg
vrvnaisagpirtlaasgikdfrkmlahceavtpirrtvtiedvgnsaaflcsdlsagis
gevvhvdggfsiaamne

SCOPe Domain Coordinates for d1qg6a_:

Click to download the PDB-style file with coordinates for d1qg6a_.
(The format of our PDB-style files is described here.)

Timeline for d1qg6a_: