Lineage for d1zid__ (1zid -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20186Protein Enoyl-ACP reductase [51791] (3 species)
  7. 20212Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (4 PDB entries)
  8. 20214Domain d1zid__: 1zid - [29911]

Details for d1zid__

PDB Entry: 1zid (more details), 2.7 Å

PDB Description: long fatty acid chain enoyl-acp reductase (inha) in complex with an isonicotinic-acyl-nadh inhibitor

SCOP Domain Sequences for d1zid__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zid__ c.2.1.2 (-) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA}
aglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

SCOP Domain Coordinates for d1zid__:

Click to download the PDB-style file with coordinates for d1zid__.
(The format of our PDB-style files is described here.)

Timeline for d1zid__: