SCOPe 2.05: Domain d1enya_: 1eny A:

Lineage for d1enya_ (1eny A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (58 PDB entries)

8. Domain d1enya_: 1eny A: [29910]
   complexed with nad

Details for d1enya_

PDB Entry: 1eny, 2.2 Å

PDB Description: crystal structure and function of the isoniazid target of mycobacterium tuberculosis

PDB Compounds: (A:) enoyl-acyl carrier protein (acp) reductase

SCOPe Domain Sequences for d1enya_:

Sequence; same for both SEQRES and ATOM records:

>d1enya_ c.2.1.2 (A:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
aglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

Timeline for d1enya_:

• d1enya_ first appeared (with stable ids) in SCOP 1.55, called d1eny__
  
• d1enya_ appears in SCOPe 2.04
  
• d1enya_ appears in SCOPe 2.06
  
• d1enya_ appears in the current release, SCOPe 2.08, called d1enya1