Lineage for d1enya1 (1eny A:3-269)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. Protein Enoyl-ACP reductase [51791] (11 species)
  7. Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (95 PDB entries)
  8. Domain d1enya1: 1eny A:3-269 [29910]
    Other proteins in same PDB: d1enya2
    complexed with nad

Details for d1enya1

PDB Entry: 1eny (more details), 2.2 Å

PDB Description: crystal structure and function of the isoniazid target of mycobacterium tuberculosis
PDB Compounds: (A:) enoyl-acyl carrier protein (acp) reductase

SCOPe Domain Sequences for d1enya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enya1 c.2.1.2 (A:3-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
callsdwlpattgdiiyadggahtqll

SCOPe Domain Coordinates for d1enya1 are not available.

Timeline for d1enya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1enya2