Lineage for d1eno__ (1eno -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20186Protein Enoyl-ACP reductase [51791] (3 species)
  7. 20222Species Oil seed rape (Brassica napus) [TaxId:3708] [51792] (4 PDB entries)
  8. 20223Domain d1eno__: 1eno - [29905]

Details for d1eno__

PDB Entry: 1eno (more details), 1.9 Å

PDB Description: brassica napus enoyl acp reductase/nad binary complex at ph 8.0 and room temperature

SCOP Domain Sequences for d1eno__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eno__ c.2.1.2 (-) Enoyl-ACP reductase {Oil seed rape (Brassica napus)}
lpidlrgkrafiagiaddngygwavakslaaagaeilvgtwvpalnifetslrrgkfdqs
rvlpdgslmeikkvypldavfdnpedvpedvkankryagssnwtvqeaaecvrqdfgsid
ilvhslangpevskplletsrkgylaaisassysfvsllshflpimnpggasisltyias
eriipgygggmssakaalesdtrvlafeagrkqnirvntisagplgsraakaigfidtmi
eysynnapiqktltadevgnaaaflvsplasaitgatiyvdnglnsmgvaldspvfk

SCOP Domain Coordinates for d1eno__:

Click to download the PDB-style file with coordinates for d1eno__.
(The format of our PDB-style files is described here.)

Timeline for d1eno__: