Lineage for d1i01b_ (1i01 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090798Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 2090799Species Escherichia coli [TaxId:562] [51790] (3 PDB entries)
  8. 2090807Domain d1i01b_: 1i01 B: [29898]

Details for d1i01b_

PDB Entry: 1i01 (more details), 2.6 Å

PDB Description: crystal structure of beta-ketoacyl [acyl carrier protein] reductase from e. coli.
PDB Compounds: (B:) beta-ketoacyl [acp] reductase

SCOPe Domain Sequences for d1i01b_:

Sequence, based on SEQRES records: (download)

>d1i01b_ c.2.1.2 (B:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]}
mnfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnv
tdpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlska
vmrammkkrhgriitigsvvgtmgnggqanyaaakagligfskslarevasrgitvnvva
pgfietdmtralsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvngg
m

Sequence, based on observed residues (ATOM records): (download)

>d1i01b_ c.2.1.2 (B:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]}
mnfegkialvtgasrgigraiaetlaargakvigtatsengaqaisdylgangkglmlnv
tdpasiesvlekiraefgevdilvnnagitrdnllmrmkdeewndiietnlssvfrlska
vmrammkkrhgriitigsvvgtgqanyaaakagligfskslarevasrgitvnvvapgfi
etsddqragilaqvpagrlggaqeianavaflasdeaayitgetlhvnggm

SCOPe Domain Coordinates for d1i01b_:

Click to download the PDB-style file with coordinates for d1i01b_.
(The format of our PDB-style files is described here.)

Timeline for d1i01b_: