Lineage for d4kiwf_ (4kiw F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857936Protein automated matches [190071] (6 species)
    not a true protein
  7. 2858010Species Mycobacterium tuberculosis [TaxId:1773] [189947] (16 PDB entries)
  8. 2858214Domain d4kiwf_: 4kiw F: [298938]
    automated match to d3n59m_
    complexed with kiw

Details for d4kiwf_

PDB Entry: 4kiw (more details), 2.57 Å

PDB Description: design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49e [5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid]
PDB Compounds: (F:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4kiwf_:

Sequence, based on SEQRES records: (download)

>d4kiwf_ c.23.13.1 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh

Sequence, based on observed residues (ATOM records): (download)

>d4kiwf_ c.23.13.1 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrggtthdelvaliereaaelglkavvrqsdseaqlldwihqaad
aaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiatgvivg
lgiqgyllalrylaeh

SCOPe Domain Coordinates for d4kiwf_:

Click to download the PDB-style file with coordinates for d4kiwf_.
(The format of our PDB-style files is described here.)

Timeline for d4kiwf_: