Lineage for d1gegd_ (1geg D:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686975Protein meso-2,3-butanediol dehydrogenase [51786] (1 species)
  7. 686976Species Klebsiella pneumoniae [TaxId:573] [51787] (1 PDB entry)
  8. 686980Domain d1gegd_: 1geg D: [29891]

Details for d1gegd_

PDB Entry: 1geg (more details), 1.7 Å

PDB Description: cryatal structure analysis of meso-2,3-butanediol dehydrogenase
PDB Compounds: (D:) acetoin reductase

SCOP Domain Sequences for d1gegd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gegd_ c.2.1.2 (D:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}
kkvalvtgagqgigkaialrlvkdgfavaiadyndatakavaseinqagghavavkvdvs
drdqvfaaveqarktlggfdvivnnagvapstpiesitpeivdkvyninvkgviwgiqaa
veafkkeghggkiinacsqaghvgnpelavyssskfavrgltqtaardlaplgitvngyc
pgivktpmwaeidrqvseaagkplgygtaefakritlgrlsepedvaacvsylaspdsdy
mtgqsllidggmvfn

SCOP Domain Coordinates for d1gegd_:

Click to download the PDB-style file with coordinates for d1gegd_.
(The format of our PDB-style files is described here.)

Timeline for d1gegd_: