SCOPe 2.05: Domain d1gcof_: 1gco F:

Lineage for d1gcof_ (1gco F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Glucose dehydrogenase [51784] (1 species)

7. Species Bacillus megaterium [TaxId:1404] [51785] (4 PDB entries)

8. Domain d1gcof_: 1gco F: [29887]
   complexed with nad

Details for d1gcof_

PDB Entry: 1gco, 1.7 Å

PDB Description: crystal structure of glucose dehydrogenase complexed with nad+

PDB Compounds: (F:) glucose dehydrogenase

SCOPe Domain Sequences for d1gcof_:

Sequence; same for both SEQRES and ATOM records:

>d1gcof_ c.2.1.2 (F:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]}
mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
gitlfadggmtqypsfqagrg

Timeline for d1gcof_:

• d1gcof_ first appeared (with stable ids) in SCOP 1.55
  
• d1gcof_ appears in SCOPe 2.04
  
• d1gcof_ appears in SCOPe 2.06
  
• d1gcof_ appears in the current release, SCOPe 2.08