Lineage for d1a4ua_ (1a4u A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66266Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)
  6. 66375Protein Drosophila alcohol dehydrogenase [51782] (1 species)
  7. 66376Species Fruit fly (Drosophila lebanonensis) [51783] (5 PDB entries)
  8. 66380Domain d1a4ua_: 1a4u A: [29878]

Details for d1a4ua_

PDB Entry: 1a4u (more details), 1.92 Å

PDB Description: alcohol dehydrogenase from drosophila lebanonensis

SCOP Domain Sequences for d1a4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4ua_ c.2.1.2 (A:) Drosophila alcohol dehydrogenase {Fruit fly (Drosophila lebanonensis)}
mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
leaiewtkhwdshi

SCOP Domain Coordinates for d1a4ua_:

Click to download the PDB-style file with coordinates for d1a4ua_.
(The format of our PDB-style files is described here.)

Timeline for d1a4ua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a4ub_