Lineage for d4k2ed_ (4k2e D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (76 species)
    not a true protein
  7. 2307655Species Vibrio cholerae [TaxId:243277] [256837] (2 PDB entries)
  8. 2307659Domain d4k2ed_: 4k2e D: [298751]
    automated match to d4ooib_

Details for d4k2ed_

PDB Entry: 4k2e (more details), 1.8 Å

PDB Description: HlyU from Vibrio cholerae N16961
PDB Compounds: (D:) Transcriptional activator HlyU

SCOPe Domain Sequences for d4k2ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2ed_ a.4.5.0 (D:) automated matches {Vibrio cholerae [TaxId: 243277]}
meknsakavvllkamanerrlqilcmlldnelsvgelssrlelsqsalsqhlawlrrdgl
vntrkeaqtvfytlsstevkamiellhrlycq

SCOPe Domain Coordinates for d4k2ed_:

Click to download the PDB-style file with coordinates for d4k2ed_.
(The format of our PDB-style files is described here.)

Timeline for d4k2ed_: