Lineage for d1bdb__ (1bdb -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66266Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)
  6. 66360Protein Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase [51780] (1 species)
  7. 66361Species Pseudomonas sp., lb400 [TaxId:306] [51781] (1 PDB entry)
  8. 66362Domain d1bdb__: 1bdb - [29874]

Details for d1bdb__

PDB Entry: 1bdb (more details), 2 Å

PDB Description: cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase from pseudomonas sp. lb400

SCOP Domain Sequences for d1bdb__:

Sequence, based on SEQRES records: (download)

>d1bdb__ c.2.1.2 (-) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400}
mklkgeavlitggasglgralvdrfvaegakvavldksaerlaeletdhgdnvlgivgdv
rsledqkqaasrcvarfgkidtlipnagiwdystalvdlpeesldaafdevfhinvkgyi
havkaclpalvasrgnviftisnagfypngggplytaakhaivglvrelafelapyvrvn
gvgsgginsdlrgpsslgmgskaistvpladmlksvlpigrmpeveeytgayvffatrgd
aapatgallnydgglgvrgffsgaggndlleqlnih

Sequence, based on observed residues (ATOM records): (download)

>d1bdb__ c.2.1.2 (-) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400}
mklkgeavlitggasglgralvdrfvaegakvavldksaerlaeletdhgdnvlgivgdv
rsledqkqaasrcvarfgkidtlipnagiwdystalvdlpeesldaafdevfhinvkgyi
havkaclpalvasrgnviftisnagfypngggplytaakhaivglvrelafelapyvrvn
gvgsgginsdlrgpsslgpladmlksvlpigrmpeveeytgayvffatrgdaapatgall
nydgglgvrgffsgaggndlleqlnih

SCOP Domain Coordinates for d1bdb__:

Click to download the PDB-style file with coordinates for d1bdb__.
(The format of our PDB-style files is described here.)

Timeline for d1bdb__: