Lineage for d2hsdc_ (2hsd C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2449929Protein 3-alpha,20-beta-hydroxysteroid dehydrogenase [51776] (1 species)
  7. 2449930Species Streptomyces hydrogenans [TaxId:1905] [51777] (2 PDB entries)
  8. 2449937Domain d2hsdc_: 2hsd C: [29868]
    complexed with nad

Details for d2hsdc_

PDB Entry: 2hsd (more details), 2.64 Å

PDB Description: the refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases
PDB Compounds: (C:) 3-alpha, 20 beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d2hsdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsdc_ c.2.1.2 (C:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}
ndlsgktviitggarglgaeaarqavaagarvvladvldeegaatarelgdaaryqhldv
tieedwqrvvayareefgsvdglvnnagistgmfletesverfrkvveinltgvfigmkt
vipamkdagggsivnissaaglmglaltssygaskwgvrglsklaavelgtdrirvnsvh
pgmtytpmtaetgirqgegnypntpmgrvgepgeiagavvkllsdtssyvtgaelavdgg
wttgptvkyvmgq

SCOPe Domain Coordinates for d2hsdc_:

Click to download the PDB-style file with coordinates for d2hsdc_.
(The format of our PDB-style files is described here.)

Timeline for d2hsdc_: