Lineage for d2hsdb_ (2hsd B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841568Protein 3-alpha,20-beta-hydroxysteroid dehydrogenase [51776] (1 species)
  7. 2841569Species Streptomyces hydrogenans [TaxId:1905] [51777] (2 PDB entries)
  8. 2841575Domain d2hsdb_: 2hsd B: [29867]
    complexed with nad

Details for d2hsdb_

PDB Entry: 2hsd (more details), 2.64 Å

PDB Description: the refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases
PDB Compounds: (B:) 3-alpha, 20 beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d2hsdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsdb_ c.2.1.2 (B:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}
ndlsgktviitggarglgaeaarqavaagarvvladvldeegaatarelgdaaryqhldv
tieedwqrvvayareefgsvdglvnnagistgmfletesverfrkvveinltgvfigmkt
vipamkdagggsivnissaaglmglaltssygaskwgvrglsklaavelgtdrirvnsvh
pgmtytpmtaetgirqgegnypntpmgrvgepgeiagavvkllsdtssyvtgaelavdgg
wttgptvkyvmgq

SCOPe Domain Coordinates for d2hsdb_:

Click to download the PDB-style file with coordinates for d2hsdb_.
(The format of our PDB-style files is described here.)

Timeline for d2hsdb_: