Lineage for d1hdcb_ (1hdc B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2090742Protein 3-alpha,20-beta-hydroxysteroid dehydrogenase [51776] (1 species)
  7. 2090743Species Streptomyces hydrogenans [TaxId:1905] [51777] (2 PDB entries)
  8. 2090745Domain d1hdcb_: 1hdc B: [29863]
    complexed with cbo

Details for d1hdcb_

PDB Entry: 1hdc (more details), 2.2 Å

PDB Description: mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor
PDB Compounds: (B:) 3-alpha, 20 beta-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d1hdcb_:

Sequence, based on SEQRES records: (download)

>d1hdcb_ c.2.1.2 (B:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}
ndlsgktviitggarglgaeaarqavaagarvvladvldeegaatarelgdaaryqhldv
tieedwqrvvayareefgsvdglvnnagistgmfletesverfrkvveinltgvfigmkt
vipamkdagggsivnissaaglmglaltssygaskwgvrglsklaavelgtdrirvnsvh
pgmtytpmtaetgirqgegnypntpmgrvgnepgeiagavvkllsdtssyvtgaelavdg
gwttgptvkyvmgq

Sequence, based on observed residues (ATOM records): (download)

>d1hdcb_ c.2.1.2 (B:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}
ndlsgktviitggarglgaeaarqavaagarvvladvldeegaatarelgdaaryqhldv
tieedwqrvvayareefgsvdglvnnagistgmfletesverfrkvveinltgvfigmkt
vipamkdagggsivnissaaglmglaltssygaskwgvrglsklaavelgtdrirvnsvh
pgmtytpmtaetgirqgegnypntpmgrvgepgeiagavvkllsdtssyvtgaelavdgg
wttgptvkyvmgq

SCOPe Domain Coordinates for d1hdcb_:

Click to download the PDB-style file with coordinates for d1hdcb_.
(The format of our PDB-style files is described here.)

Timeline for d1hdcb_: