Lineage for d1bhs__ (1bhs -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20247Protein Human estrogenic 17beta-hydroxysteroid dehydrogenase [51772] (1 species)
  7. 20248Species Human (Homo sapiens) [TaxId:9606] [51773] (11 PDB entries)
  8. 20251Domain d1bhs__: 1bhs - [29840]

Details for d1bhs__

PDB Entry: 1bhs (more details), 2.2 Å

PDB Description: human estrogenic 17beta-hydroxysteroid dehydrogenase

SCOP Domain Sequences for d1bhs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhs__ c.2.1.2 (-) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens)}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevf
ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevf

SCOP Domain Coordinates for d1bhs__:

Click to download the PDB-style file with coordinates for d1bhs__.
(The format of our PDB-style files is described here.)

Timeline for d1bhs__: