![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein Dihydropteridin reductase (pteridine reductase) [51769] (7 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [51770] (2 PDB entries) |
![]() | Domain d1dirc_: 1dir C: [29835] complexed with nad |
PDB Entry: 1dir (more details), 2.6 Å
SCOPe Domain Sequences for d1dirc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dirc_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Norway rat (Rattus norvegicus) [TaxId: 10116]} earrvlvyggrgalgsrcvqafrarnwwvasidvveneeasasvivkmtdsfteqadqvt aevgkllgdqkvdailcvaggwaggnakskslfkncdlmwkqsiwtstisshlatkhlke gglltlagakaaldgtpgmigygmakgavhqlcqslagknsgmpsgaaaiavlpvtldtp mnrksmpeadfsswtpleflvetfhdwitgnkrpnsgsliqvvttdgkteltpayf
Timeline for d1dirc_: