Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (45 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Dihydropteridin reductase (pteridine reductase) [51769] (6 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [51770] (2 PDB entries) |
Domain d1dirc_: 1dir C: [29835] |
PDB Entry: 1dir (more details), 2.6 Å
SCOP Domain Sequences for d1dirc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dirc_ c.2.1.2 (C:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus)} earrvlvyggrgalgsrcvqafrarnwwvasidvveneeasasvivkmtdsfteqadqvt aevgkllgdqkvdailcvaggwaggnakskslfkncdlmwkqsiwtstisshlatkhlke gglltlagakaaldgtpgmigygmakgavhqlcqslagknsgmpsgaaaiavlpvtldtp mnrksmpeadfsswtpleflvetfhdwitgnkrpnsgsliqvvttdgkteltpayf
Timeline for d1dirc_: