Lineage for d1sep__ (1sep -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20277Protein Sepiapterin reductase [51767] (1 species)
  7. 20278Species Mouse (Mus musculus) [TaxId:10090] [51768] (3 PDB entries)
  8. 20280Domain d1sep__: 1sep - [29830]

Details for d1sep__

PDB Entry: 1sep (more details), 1.95 Å

PDB Description: mouse sepiapterin reductase complexed with nadp and sepiapterin

SCOP Domain Sequences for d1sep__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sep__ c.2.1.2 (-) Sepiapterin reductase {Mouse (Mus musculus)}
adglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqpdl
kvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlaevn
nywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardmly
qvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaqkl
lgllqkdtfqsgahvdfyd

SCOP Domain Coordinates for d1sep__:

Click to download the PDB-style file with coordinates for d1sep__.
(The format of our PDB-style files is described here.)

Timeline for d1sep__: