Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Carbonyl reductase [51765] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [51766] (1 PDB entry) |
Domain d1cydd_: 1cyd D: [29828] complexed with ipa, ndp |
PDB Entry: 1cyd (more details), 1.8 Å
SCOPe Domain Sequences for d1cydd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cydd_ c.2.1.2 (D:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} lnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvdlg dwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvardm inrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnptvv ltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdagyl as
Timeline for d1cydd_: