Lineage for d1cydc_ (1cyd C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66266Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)
  6. 66351Protein Carbonyl reductase [51765] (1 species)
  7. 66352Species Mouse (Mus musculus) [TaxId:10090] [51766] (1 PDB entry)
  8. 66355Domain d1cydc_: 1cyd C: [29827]

Details for d1cydc_

PDB Entry: 1cyd (more details), 1.8 Å

PDB Description: carbonyl reductase complexed with nadph and 2-propanol

SCOP Domain Sequences for d1cydc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cydc_ c.2.1.2 (C:) Carbonyl reductase {Mouse (Mus musculus)}
lnfsglralvtgagkgigrdtvkalhasgakvvavtrtnsdlvslakecpgiepvcvdlg
dwdatekalggigpvdllvnnaalvimqpflevtkeafdrsfsvnlrsvfqvsqmvardm
inrgvpgsivnvssmvahvtfpnlitysstkgamtmltkamamelgphkirvnsvnptvv
ltdmgkkvsadpefarklkerhplrkfaevedvvnsilfllsdrsastsgggilvdagyl
as

SCOP Domain Coordinates for d1cydc_:

Click to download the PDB-style file with coordinates for d1cydc_.
(The format of our PDB-style files is described here.)

Timeline for d1cydc_: