Lineage for d4i55f2 (4i55 F:77-378)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217619Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2217620Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species)
  7. 2217621Species Chicken (Gallus gallus) [TaxId:9031] [311385] (39 PDB entries)
  8. 2217624Domain d4i55f2: 4i55 F:77-378 [298260]
    Other proteins in same PDB: d4i55a1, d4i55a2, d4i55b1, d4i55b2, d4i55c1, d4i55c2, d4i55d1, d4i55d2, d4i55e_, d4i55f1, d4i55f3
    automated match to d3tiia2
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d4i55f2

PDB Entry: 4i55 (more details), 2.2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl complex
PDB Compounds: (F:) Tubulin Tyrosine ligase, TTL

SCOPe Domain Sequences for d4i55f2:

Sequence, based on SEQRES records: (download)

>d4i55f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d4i55f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktderevflaaynrrregregnvwiaksseg
ilisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyreg
vlrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttl
ensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapaca
qklyaelcqgivdvaissvfplaptsifikl

SCOPe Domain Coordinates for d4i55f2:

Click to download the PDB-style file with coordinates for d4i55f2.
(The format of our PDB-style files is described here.)

Timeline for d4i55f2: